DPCstruct | MC43019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 111 ± 18 aa |
| Standard deviation of domain lengths | 18.11 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.53 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | CL0123- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2SU56 | 26-143 | PVLTPSEEAGSAEGGPSEHRIGPTTQLRLLRRGVARLVVEDGMAVLYHCMENSREHHGAPLRPLEFPLEDALAIDRLLAAYPNPVRV… |
| A0A6N9YF90 | 4-87 | RLTADSEVAVRGGLRWQLTPAAGGRVTLRVPDRTLTLPGTCEAALRALLTGEVTRVGDLPGLDDDADRLVLARRLLKEAVLTPA |
| A0A1Q9CKC1 | 489-617 | None |
| A0A845WG14 | 271-362 | None |
| A0A7M3RGW3 | 635-736 | None |
| A0A1D2N3X4 | 662-786 | None |
| A0A383YMU0 | 213-341 | None |
| L1K3Z9 | 284-388 | None |
| A0A815UHM1 | 1-103 | None |
| A0A2S9PX26 | 207-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.