DPCstruct | MC4301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 160 ± 39 aa |
| Standard deviation of domain lengths | 38.92 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 87.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.57 |
| Pfam Score | 98.53 |
| Assigned Pfam label(s) | CL0126- CL0139 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0JEY1 | 31-185 | LQSNYTEGNNVNVADDRANDNEGSHGVRGYDPNRQFTAAHFDYTMGYEYGGVNAGGTPFYPATSNPDVYPGAVTLFYYNNLIHDYLY… |
| A0A4S4MT98 | 12-126 | TSGNNALAFKSSQSSVTTESSAGLNFIFTQDPTQAPTVQVNLDAARTNAFYVVNTIHDVSYKYGFTEAAFNFQTNNFGKGGKGNDHV… |
| A0A4Q1EQP3 | 124-244 | None |
| A0A5B1BJ46 | 4-102 | None |
| A0A7V3UIT9 | 17-228 | None |
| T5A7V7 | 219-428 | None |
| A0A661DV69 | 283-451 | None |
| A0A0K6G9Y9 | 174-311 | None |
| A0A4Q2DGW1 | 37-239 | None |
| A0A2D5SFJ5 | 9-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.