DPCstruct | MC43005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 127 |
|---|---|
| Mean domain length (aa) | 132 ± 22 aa |
| Standard deviation of domain lengths | 22.06 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.08 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | CL0023- PF10517- PF01521 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A162QNY0 | 11-134 | PTAALLAACAAPALAQMPAPGWEAELSMISHLVSGTVVVVDEDTIRIDNFTFDGRGLDVRVYLGVDESSFASGIAVGPQLVGMPFAG… |
| A0A1S1Z5R0 | 2-96 | LSGTFIDAAHPTSGTVVLDGNTIKIESDFRSDNGPDLYIYLAQGTDGNGFVDLGRLKNVAGEQEYTVPDGVDYTKNKYVLVWCKQFS… |
| A0A1A9XMB5 | 123-272 | None |
| A0A834XX94 | 142-260 | None |
| A0A5S6QRA9 | 304-436 | None |
| A0A833WG23 | 221-383 | None |
| A0A1S8VSW1 | 11-144 | None |
| A0A2A4RDF1 | 23-151 | None |
| A0A7Y3B6S0 | 170-292 | None |
| A0A7W0PXI4 | 83-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.