DPCstruct | MC43003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 59 ± 5 aa |
| Standard deviation of domain lengths | 4.92 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 71.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L8G277 | 1-58 | IEIEKLDYHHYLPLFFDGLCETTHPYEFFARQGVHDMLEHGGPKILPVIPQLIIPIKN |
| A0A803SY31 | 23-80 | VEIEKLDYHHYLPLFFDGLCEMQFPYEFFARQGIHDMLEHGGNKILPVIPQLIMPIKN |
| G3SR22 | 3-64 | None |
| A0A7E4RSK4 | 98-154 | None |
| A0A6J3BSY7 | 100-157 | None |
| A0A5F7ZK41 | 29-100 | None |
| A0A812MYP3 | 450-507 | None |
| A0A6J1UTQ2 | 92-148 | None |
| A0A673ZX75 | 4-64 | None |
| A0A1B0CAH1 | 85-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.