DPCstruct | MC43000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 100 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P9X2A1 | 93-188 | FGEGQGHPVRSALVYSGIHYDAAEIALPDGRVVRDVTADPNAEAVRVAASALRAARQFTNTAQFTLRCSDCGQALRGEKEAQSHAAS… |
| A0A4S2LD97 | 388-488 | FGEDKNYRHRILLIYDGIHYDPLALARPDTGKLTSVFSTKNEQILWDAQALAAEARAQWRFTDTVSFTLICRQCQVPLVGQAAAQQH… |
| A0A7S1ZIQ2 | 31-132 | None |
| A0A2A3EJA3 | 1165-1265 | None |
| A0A3P7UEN2 | 89-189 | None |
| A0A5N6KT44 | 526-633 | None |
| A0A4V3XFH4 | 601-700 | None |
| A0A5C7IFM7 | 756-861 | None |
| A0A093XP88 | 359-465 | None |
| A0A094B310 | 421-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.