DPCstruct | MC4300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 6.79 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5PU20 | 1-67 | MWIIYDRPSDFPEQFVARKWIMDKPTSEVMTASDLAGIRWAVGKVAPGSVCLARDPSDDPKIVETWL |
| A0A7W0FZK6 | 6-77 | KVISTYAIYERPSDYPNHYVVRRWDVYEGVPAAVPAWDAKLADTLEGARAELPPGLDCLGRDPVDPVIVEVW |
| A0A3R6MF03 | 12-87 | None |
| A0A7G5N138 | 18-91 | None |
| A0A258L752 | 12-90 | None |
| A0A354CP61 | 118-193 | None |
| A0A2U1X3F6 | 21-89 | None |
| A0A3P3T9U6 | 81-147 | None |
| A0A149R7Y8 | 17-91 | None |
| A0A4Q3KUI1 | 18-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.