DPCstruct | MC430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 8.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H8KLA4 | 4-102 | TIKRKFWIFEPDLNCTLLLIAHVAKYDIDSDDLNAIIYGLTSTSQEKDIWWTYQFVGNKIIDLCFARDDDNTDIIFIELSFSKELSS… |
| A0A5C4QQ71 | 130-223 | VEGWVTEDHVVRLFRQISAYVGYAYDDLDEAALVGALDDTSDEVVDGWFEYPLAGTPTLVVRLALSPGSAVVNVRVEGTMDLVLATR… |
| A0A401Z0U7 | 176-275 | None |
| A0A0N9HZZ0 | 8-105 | None |
| A0A0Q5KVZ0 | 4-101 | None |
| A0A239PES7 | 1-95 | None |
| A0A7W3R6I8 | 2-84 | None |
| A0A7W5FEH5 | 163-248 | None |
| A0A6F8YRL1 | 80-151 | None |
| A0A810N980 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.