DPCstruct | MC42994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 192 ± 27 aa |
| Standard deviation of domain lengths | 26.51 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354LXK4 | 1-195 | MGLSKEWKSFYDTQDSTYNYENYMYEIHKGLDCSGYIGWTIYNTLETKSNHGNGYVLKAEEMTKTYANMKLGSYKDSIQNAKPGDIV… |
| A0A1C5L4K5 | 69-265 | LGVSASWKKFYKKQKKGYNYRKYLFQSSKGLDCSGYIGWCIYNVLEETDGKKGYVLYAQNMARNYASRGWGTFTKRSKVKNYKAGDI… |
| A0A372SHQ6 | 90-282 | None |
| A0A351UT30 | 141-361 | None |
| A0A3D2IS69 | 99-298 | None |
| A0A662Z4T1 | 176-367 | None |
| A0A395Y6E9 | 2-141 | None |
| A0A316PA82 | 41-233 | None |
| A0A645DJZ5 | 1-147 | None |
| A0A848CJC7 | 277-477 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.