DPCstruct | MC42991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 6.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01887 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T2SWH6 | 4-73 | SSASPLITITTDFGTEDAYVPSMKGTMLSICPEARLVDVTHEISPQDVMEAAFVLRSTRAHFPDETIHLV |
| A0A2V7KTG4 | 1-60 | MTVITLLTDFGTADSYVAEMKGVLSTYAPNAKLVDITHEVSPGDVRAAQYILSRTWMFFP |
| A0A7C2VCU1 | 35-100 | None |
| A0A2N3ZBX3 | 166-238 | None |
| A0A661JI30 | 346-418 | None |
| E1LQC3 | 2-65 | None |
| A0A538S658 | 2-69 | None |
| A0A7V2XG15 | 320-398 | None |
| A0A7Y4YJD9 | 1-68 | None |
| A0A3B9P7P7 | 250-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.