DPCstruct | MC42984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 9.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q7TLW1 | 71-156 | MAATVMGQAEVSASGRPFCIQVASPSDYTPARTLLDLSPLTMRAATASGRSMMHHAILVVADPAGAQLFHWSYHKRQFVPGTLNDR |
| A0A0C1GNJ3 | 1-100 | MTVPVVLIQSRLIADGSPYCIAEHAENSPVKALHELRGFAFYTTKTGYKTTSAWYFHGLLVVDHPEEQRIYNWSPRRWRFDRIAEPD… |
| A0A7Y7DB64 | 108-197 | None |
| A0A4P6FV16 | 1-127 | None |
| A0A537N5I0 | 132-236 | None |
| A0A6P0BZQ9 | 14-119 | None |
| A6UAI1 | 47-145 | None |
| A0A4Q6DPA0 | 5-104 | None |
| A0A7X3MX94 | 149-252 | None |
| A0A438AL10 | 207-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.