DPCstruct | MC42983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 56 ± 4 aa |
| Standard deviation of domain lengths | 4.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W5M882 | 1-56 | MRGSLLIAATSILALSIATADARNTPCSGKKGGVKGCLGEKFLCNDGTTSASKRTC |
| A0A1G5W0M3 | 7-63 | TSALLRTCVAILLLALVTSALAANQPCSGRKGGIAGCDGDTFLCNDGSISASKKSCS |
| A0A809SJK8 | 3-59 | None |
| A0A378K0K0 | 1-53 | None |
| K0VTD2 | 11-57 | None |
| A0A4Q7VBU6 | 39-103 | None |
| L2F5T8 | 1-58 | None |
| A0A1J5B8B1 | 42-96 | None |
| A0A6N1KUU2 | 1-57 | None |
| A0A659V9I1 | 5-50 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.