DPCstruct | MC4298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 78 ± 4 aa |
| Standard deviation of domain lengths | 4.09 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1EK71 | 10-91 | YVPCPRCGNPYPQPVGYTLWGGFIGPKLLKHVKCHQCGYTFNGKTGQSNDKAILLYLTVPVVVLVLLLMACLICSAMSSAST |
| A0A7V9UKM5 | 2-76 | SEYVACPQCTQPDPEKIKFTWWGGVIGPRMLKHVKCRSCAMTYNGKTGQSNTTNIVIYSVVVFIIFLGIGIFIFS |
| A0A7W1A9G4 | 8-82 | None |
| A0A1M3N5C6 | 115-192 | None |
| A0A2V8SRS8 | 1-85 | None |
| A0A151EMF8 | 170-246 | None |
| A0A059X1B5 | 47-127 | None |
| A0A5C5WIN2 | 34-107 | None |
| A0A538RZ09 | 79-161 | None |
| A0A2T1F8E5 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.