DPCstruct | MC42979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 97 ± 18 aa |
| Standard deviation of domain lengths | 17.96 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 91.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9P701 | 1-101 | MASAASAGTFEARSATVSRVTNETKIQVSLSLDTHPTLAPQTISVKTGIGFLDHMLHALAKHGGMSLTLACDGDLWIDDHHTAEDCA… |
| A0A6N7X2I7 | 2-90 | RKAEVNRSTGETQVQLYLDLDGSGWSEIDTGIGFMDHMLVLLAKHAGFDLKVKCQGDVYVDDHHSVEDIGISLGLAFAKALGDKQGI… |
| Q1Q1C5 | 78-171 | None |
| A0A545UUI3 | 2-144 | None |
| A0A2S6U6B4 | 81-172 | None |
| R1C3L4 | 149-252 | None |
| A0A446MPZ1 | 20-113 | None |
| A0A1E7FWI6 | 14-106 | None |
| A0A4Y8D8J0 | 1-129 | None |
| A0A7C7DPR3 | 511-624 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.