DPCstruct | MC42978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 81 ± 3 aa |
| Standard deviation of domain lengths | 3.41 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 76.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 73.50 |
| Pfam Score | 87.27 |
| Assigned Pfam label(s) | CL0409- PF00786 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1NW86 | 1-72 | HVAHVTFDRRQGFLGLPVEFELQIPCPAPSASTSVFGVSPESMQCGYDDRGNSVPKILLLMQEWLYTQDGLK |
| A0A2K3M780 | 1-84 | MDISSPTNVRHVAHVTFDRFNGFLGLPDEFEPDFPRRPPSASATVFGVSTESMQLSYDSRGNSVPTILLLMQRHLYVQGGLQVE |
| A0A1D1Y3G7 | 24-101 | None |
| A0A2U1PZ12 | 98-177 | None |
| A0A6A6L4Y7 | 1-80 | None |
| A0A0A9NG50 | 1-88 | None |
| A0A453PA28 | 48-128 | None |
| A0A5N5FXM5 | 111-190 | None |
| A0A5P1E1I8 | 15-98 | None |
| A0A7J8ZCQ5 | 108-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.