DPCstruct | MC42977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 104 ± 21 aa |
| Standard deviation of domain lengths | 21.42 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 51.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8V5U8 | 3-80 | RRVLVHLPSGEVVSSYSSLEHILRGLGWERYYGGDPDLYQFHKHSSIDLISLPKDFSKFCSVHMYDIVVKNPNVFHVR |
| T1NKM5 | 1-97 | GVWVFRKDGVMELAQEASSRKALVYLPANETMRSLPALERRLGSLGWERYYEDRALVQLHRRDGSLDLISLPRDFSQFRSIHMYDVV… |
| A0A1P8BBN7 | 37-144 | None |
| A0A4S8I7F1 | 9-66 | None |
| A0A2R6X066 | 57-204 | None |
| A0A834X0X3 | 65-176 | None |
| A0A2S3HNE2 | 142-251 | None |
| A0A453MSG1 | 1-68 | None |
| A0A835KQV6 | 68-182 | None |
| A0A835KYC6 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.