DPCstruct | MC42976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 190 ± 32 aa |
| Standard deviation of domain lengths | 32.47 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 71.76 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | PF01405- PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4N2W3 | 20-244 | YGPGIWVSDPYGLTGRVQPVNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSSSIAAVFFA… |
| T1NHN7 | 16-242 | GAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTR… |
| A0A453DVM0 | 1-133 | None |
| A0A7J9KP56 | 2-182 | None |
| A0A830C908 | 13-183 | None |
| A0A445EVY0 | 28-245 | None |
| A0A650F2R9 | 2-182 | None |
| A0A7J7L242 | 113-310 | None |
| A0A7J7LK22 | 130-337 | None |
| B9SH38 | 162-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.