DPCstruct | MC42975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 59 ± 3 aa |
| Standard deviation of domain lengths | 3.47 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 52.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1NGL0 | 1-63 | EDEFFSQSDGFPRMAFPHSWRGKNGLYATGFTRRGLMGSSYDASRIAADIANQWTEALARNIT |
| A0A2Z6P8P8 | 25-81 | YKYALNDKGMPKNAFPKHWKGDHGLYCVGLARRGLFGVKVDAELIAEDINQSLNLRN |
| A0A2U1NJL3 | 118-179 | None |
| A0A7J6W857 | 1-59 | None |
| A0A6A1VH71 | 79-138 | None |
| A0A453MMC7 | 10-62 | None |
| A0A0B2PKI8 | 214-273 | None |
| A0A6A3AXJ4 | 908-967 | None |
| A0A6A2Y6I0 | 79-140 | None |
| A0A287T372 | 82-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.