DPCstruct | MC42968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 245 ± 44 aa |
| Standard deviation of domain lengths | 44.02 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9AHE1 | 1-232 | MEIGKYNCNDIHRASKKNTVNIFLPYKTPILHGAIKIIKDFTDDKDDGVDYINLCKEIYKYVNVQKECINPDLRRTKDKLFKREWKE… |
| A0A1A9ATC9 | 5-179 | LVEIINEFSKYKNDGIHYKNLCEELLKYFKVQKRCVREEVTSQGQKFKTYEWNNIVNALYTTFESKKIKRLCYLEKDNDENKKKDVL… |
| A0A1D3JFH8 | 1-282 | None |
| A0A1A9AQQ8 | 1-289 | None |
| A0A1A9ANZ6 | 1-283 | None |
| A0A1A9ALM8 | 5-204 | None |
| A0A1A9AK49 | 4-182 | None |
| A0A1A9AP09 | 1-283 | None |
| A0A1A9ASG0 | 4-214 | None |
| A0A1A9AR48 | 5-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.