DPCstruct | MC42967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 232 ± 25 aa |
| Standard deviation of domain lengths | 25.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 29.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9AEY4 | 123-356 | SIVNGTKLNKFYELLEKHYGVSTSRNCDYLDEYSIKDKSVICELLEVVKNILEKWDDTYPKYEELNPNKTCTYLNYWLYDKLLYKDA… |
| A0A1A9AKS4 | 5-229 | DQGLYELLQKDSIVNGTKLNKFYELLEKHYGVSTSRNCDYLEKYSIKDKSVICELLEVVKNILEKWDDTYAKYEELNPNKTCTYLNY… |
| A0A0J9VSW8 | 1-227 | None |
| A0A0J9VU18 | 3-210 | None |
| A0A0J9TH04 | 2-267 | None |
| A0A0J9SJR9 | 9-247 | None |
| A0A0J9SLM7 | 3-193 | None |
| A0A1A8X6L3 | 1-273 | None |
| A0A0J9SD97 | 13-281 | None |
| A5K689 | 1-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.