DPCstruct | MC42965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 192 ± 18 aa |
| Standard deviation of domain lengths | 17.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9AC79 | 65-235 | MDTRSKKKWIKEWDSQRSKYFSRLYQEEGFINMCFPNKYPKKNQSLNQLLSRHIKFCKEKDVLRADVVAKPEYSKCVKYNSWIDTQR… |
| A0A1A9A766 | 1-167 | MDDHGRGKLNSEWSTKKNVFLKKLFEEEGFIYMCSPKKNTNNPSLNQLLSRHIKFCKEKDMLRADVVAKPEYSKCVKYNSWIDTQRT… |
| A0A1A9A9L6 | 76-276 | None |
| A0A1A9AL83 | 267-471 | None |
| A0A1A9AKG7 | 65-261 | None |
| A0A1A9AJ77 | 4-199 | None |
| A0A1A9A8D7 | 1-150 | None |
| A0A1A9ASZ3 | 65-264 | None |
| A0A1A9AT96 | 65-264 | None |
| A0A1A9ASD1 | 80-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.