DPCstruct | MC42963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 133 ± 24 aa |
| Standard deviation of domain lengths | 24.48 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8YLG1 | 92-216 | NKFSPSDVKMPGVYSNRRKSLDKDMKYATKREIDILRSFCKQTGCHTCGVVCHEKFIGDHQPPVQVIKDIIDYYNKKKFLLYFLKLF… |
| A0A833LZT8 | 57-163 | KATYKEALRRYGELQDAGIAPGRFCVEWQPARGPERNWTAAEIRENNRIGAKFGCHTCGTKESGLPDNRFVLDHQPPTATNHLSRPQ… |
| A0A0J9THI5 | 145-290 | None |
| A0A2K1JC45 | 141-268 | None |
| L1LFZ1 | 195-325 | None |
| A0A7S0YJE1 | 320-474 | None |
| A0A7S4A838 | 1-126 | None |
| A0A0D2MM96 | 92-243 | None |
| A0A0C2J8C2 | 129-216 | None |
| A0A6P8I1E9 | 17-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.