DPCstruct | MC42962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 99 ± 15 aa |
| Standard deviation of domain lengths | 14.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.43 |
| Pfam Score | 98.96 |
| Assigned Pfam label(s) | PF07891- PF01199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8YI02 | 2-107 | AQRVHYRKHNHYNTKSNKVRPVRTPGGKLTVHVLKKKAGKPKCADCKSDIQGALRPADNKRTKKKNRTVSRAYGGSLCARCLRERIM… |
| S9V8B9 | 2-91 | KVVRTPGNRLVLQKRTKRSQGIHTPWVLGHKRLGGTKALRHIDARLASRHAKTVSRAYGGVLSHDQVRDRVVRAFLIEEQRIVKKAL… |
| A0A1E3IJW0 | 1-80 | None |
| A0A1D2R1G8 | 1-95 | None |
| T1H0T5 | 1-64 | None |
| A0A813QS80 | 153-255 | None |
| A0A0R3UL41 | 1-111 | None |
| A0A131Y3B3 | 9-82 | None |
| A0A6G0XTS6 | 19-102 | None |
| A0A1S8VMU8 | 62-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.