DPCstruct | MC42961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 121 ± 10 aa |
| Standard deviation of domain lengths | 9.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 52.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07756 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U9Z9T6 | 1-113 | MIYDLDWDEDARLDEWRAALCQADGLPAVLQAIIALDAWNELSVLQHAPWLGRLLSASILRHAGVTTGAHLAGINSGLRTIPVDRRR… |
| A0A442GWD9 | 1-111 | MIRDLDWDEDRRLADWLAVVDQVKNMPAVLAAAIAWEAWQDFEPLQHQHWLGTLLVAGLLRQRGKVGSHLFCLNAGLRIVPRERRKS… |
| A0A212SAQ2 | 93-196 | None |
| A0A7W5BRE1 | 125-248 | None |
| A0A4R1SXT7 | 76-199 | None |
| S3H604 | 37-155 | None |
| A0A858J7Q9 | 27-155 | None |
| J3HQL4 | 93-230 | None |
| A0A439VCL7 | 57-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.