DPCstruct | MC4296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 295 ± 35 aa |
| Standard deviation of domain lengths | 35.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15420- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A399J6Q7 | 1-293 | MVAAVLSVTPSLLPRPASLQGVLAALAFGVGYLVGVLVWGAVRAALLRRFTLPRPGRNSWIAYALVWLVAVIALPSLALHWQNEIRQ… |
| A0A346XU32 | 33-379 | PSAPMATVAWLDSFSPSLMPRTSVLQGVVGGLAVLSMRTIADRSEAALEPLLGPHLATRRRLLVRGGLAVLGLGLSNLPERGDERLW… |
| F6EED3 | 1-299 | None |
| A0A836REV0 | 6-240 | None |
| A0A7T9E103 | 20-319 | None |
| W5TNG7 | 423-685 | None |
| A0A0Q9U8D2 | 2-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.