DPCstruct | MC42958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 65 ± 9 aa |
| Standard deviation of domain lengths | 8.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.23 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0172- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831AYC2 | 1-66 | MKNDLHLVCPHCQSINRVPTAKLSEHPNCGRCQQPLFTGEPIELTTATFSRHVERSDLPLLVDFWA |
| A0A381GIR8 | 2-69 | NTVCTSCQAINRIPDDRVQEAAKCGRCGHDLFDGEVINATGETLDKLLKDDLPVVVDFWAPWCGPCRN |
| A0A7I8MXP1 | 42-110 | None |
| A0A6D0DA23 | 1-52 | None |
| A0A377AH84 | 1-48 | None |
| A0A521YNP4 | 21-97 | None |
| A0A6D0M1R7 | 2-60 | None |
| A0A3S0EH73 | 2-65 | None |
| A0A4Q4XB59 | 100-162 | None |
| A0A653AHX4 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.