DPCstruct | MC42957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 70 ± 2 aa |
| Standard deviation of domain lengths | 1.92 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 85.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 69.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7R847 | 110-180 | LIIAIVQFIVITKGAERVSEVAARFTLDAMPGKQMAIDADLNAGLITEREALERRKQVQQEAKFYGAMDGA |
| A0A090PD40 | 113-183 | IILMIINFMVVTKGAGRISEVSARFTLDALPGKQMAIDADLNAGLIDQDQARTRRQEVTKEADFYGSMDGA |
| A0A7T9DEX4 | 134-204 | None |
| A0A0U1HH72 | 131-201 | None |
| A0A080JBT5 | 2-68 | None |
| A0A090RZD9 | 1-68 | None |
| H5V0T0 | 2-68 | None |
| A0A381GS07 | 1-68 | None |
| A0A489FML9 | 116-186 | None |
| A0A6L5C5S0 | 108-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.