DPCstruct | MC42954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 152 ± 12 aa |
| Standard deviation of domain lengths | 11.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T8IHU1 | 4-147 | ATAHMMAILGIHPETYLVRITSLEYVNYRRMLISGHTHTVAKIEDPYDLKPHPFLPGLMLPTIKPSQRLGLECLNVVYTNSGISLLK… |
| A0A828N451 | 12-175 | SYRNADLIKENYITEKVLSIFNIKRDFVAVRIQSNQFTDLKNKTIQGHKDTVAKVIDWYNPQKNAFGIMMGTPRRSADIAKEESRNA… |
| A0A3M2UUP5 | 22-157 | None |
| A0A0S4UUD5 | 112-273 | None |
| A0A228PYT2 | 334-489 | None |
| A0A1X7AKX4 | 47-206 | None |
| A0A2J6HQK7 | 6-131 | None |
| A0A3S8ZSS3 | 123-283 | None |
| A0A5K6V5W1 | 55-214 | None |
| A0A1I1Y109 | 46-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.