DPCstruct | MC42951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 91 ± 16 aa |
| Standard deviation of domain lengths | 15.99 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538R1J6 | 1-80 | MISSGRPDAGINGLGFRPMPGGGRGIYESPPLQWTRLVVVNELPVARDTLLVRLLGAGSVLKQAIAELQSLPAEAPERRL |
| A0A6P0V138 | 158-248 | PRLWILGSSISEETLEGFGAEASTKEETGIYVMAPAFKTGLVAIDELPNSKETLWLRLLGRGKVRHQAILELVALPAHHSLRSVSLE… |
| A0A5P8WGB0 | 21-113 | None |
| A0A7C3VKM8 | 106-195 | None |
| Q114Y0 | 117-205 | None |
| I4G7I0 | 3-84 | None |
| A0A433URT0 | 114-199 | None |
| A0A6P0U421 | 13-95 | None |
| A0A845Z871 | 2-78 | None |
| A0A850BNB4 | 2-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.