DPCstruct | MC42945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 197 ± 35 aa |
| Standard deviation of domain lengths | 35.04 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.89 |
| Pfam Score | 86.23 |
| Assigned Pfam label(s) | PF00547- PF00699- PF18473 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538QE29 | 2-188 | RLVPREIDKLLLHQAGVLAQKRLARGVRLNYPEAVALIATQLQVMDGVPELVTEVQVEGTFPDGTKLVTVHHPIVADHGDLALALYG… |
| A0A430FLE9 | 70-291 | MRLTPRETDKLMLYLAGQLAKDRKSRGVKLNYVEAIALITSECVERAREGATVAELMQYGRTLLKPEDVMDGVAEMLEVVEVEATFP… |
| A0A6P4ZTS8 | 12-215 | None |
| A0A5J6JMM7 | 1-224 | None |
| A0A2T7PPG9 | 312-518 | None |
| A0A6A3B592 | 1-186 | None |
| C3ZHU4 | 1-137 | None |
| A0A7W0P3L2 | 13-189 | None |
| A0A438DIZ0 | 12-219 | None |
| A0A1H3IM81 | 3-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.