DPCstruct | MC42942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 182 ± 15 aa |
| Standard deviation of domain lengths | 15.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4XWA9 | 1-184 | MGEAEPSEEDSETAAQEVFTRNAFTTNALKASALTTDRVATGELTGNPLTTDAIAGSSDVLNALRDPLAREFLKYAVGCALPAGQSV… |
| A0A6N7PMR8 | 1-174 | MLAAFTGCAVAPQPTSGVAVDALESTCAGGGSTHNDMPHNDMPHNDMPHNGLTTEALQENAALLAFLSQNPLSTDAFVQAGLEVRQV… |
| A0A4U1GY76 | 7-207 | None |
| A0A3A8JIA5 | 21-181 | None |
| D0LP30 | 4-205 | None |
| A0A1H8BK72 | 23-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.