DPCstruct | MC4294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 274 ± 27 aa |
| Standard deviation of domain lengths | 27.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20712 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7QH81 | 39-322 | SDATDTAYAALIEARDYTIAQQVQLESESRSNSSTPASIDAARTALEDAGNAQGAAQGKYDAARTEVANATTAKARAASALHEVYTY… |
| A0A5C4JFA3 | 2-276 | TTTPPPAGHPRRPQREHRAAAPSINHPARRPTRLDFDALRVILAGVSLVGIAFVLFAIISPSASGLEPRDDAEIDLPAWQGALVAAG… |
| A0A1I6ELP4 | 1-272 | None |
| A0A4S2T1T1 | 1-253 | None |
| A0A4R4LMB7 | 6-213 | None |
| A0A542JFW2 | 2-280 | None |
| A0A1C6MSA8 | 6-305 | None |
| K0K3F4 | 2-273 | None |
| A0A495HT38 | 1-307 | None |
| A0A542TFQ8 | 34-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.