DPCstruct | MC42934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 166 |
|---|---|
| Mean domain length (aa) | 180 ± 39 aa |
| Standard deviation of domain lengths | 39.40 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.35 |
| Pfam Score | 99.53 |
| Assigned Pfam label(s) | PF04114- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5TI18 | 122-313 | NYYPNCDARVWLRSCTHPVEKPISGIQIGVIPTWLNGSLIRNGPGRIQVGKDTYNHLFDGSALLHRFHFKDGEVKYSNKFLKSSSYL… |
| R8BP22 | 295-463 | VFRGMNKPSRFEGDIFDLEVTGQIPKEINGTFYRVQPDARFPPVFEDDIHFNGDGSVTAIRIADGHADFKQRYVRTDRYTHETAARR… |
| A0A811R1I9 | 3-146 | None |
| A0A835J584 | 338-495 | None |
| A0A7I8KIT2 | 46-216 | None |
| A0A668S7F6 | 7-145 | None |
| A0A7W1MAS0 | 37-205 | None |
| A0A7I7P124 | 36-191 | None |
| A0A1J9RSE7 | 31-181 | None |
| A0A812Z5Q4 | 3-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.