DPCstruct | MC42921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 149 ± 15 aa |
| Standard deviation of domain lengths | 15.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521XHH3 | 19-173 | QGADKVKYETAIKPIIEKRCLSCHDGSNPHLANLNGLDNLKKVTEQDTGTDIFTLVRVSHIHLFGLTFIFYLVGTIFSHAFWRPVWL… |
| A0A7X4Y3Z3 | 102-238 | LKLVILFFSLFLMGFFFTNLLAFYSKMGFSLGSIKEYYLGNPEKFVKAKTFEGMFKVFYPHLISMAVFSVTVGHFLIFAGSSLSVPL… |
| O67303 | 161-300 | None |
| V5BYI8 | 113-260 | None |
| A0A259RWT2 | 23-165 | None |
| A0A2E0XL54 | 76-215 | None |
| A0A2P5NUY4 | 16-156 | None |
| A0A2G6KG04 | 2-156 | None |
| A0A0E2YY27 | 15-172 | None |
| A0A7C8DK10 | 2-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.