DPCstruct | MC4292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 218 ± 29 aa |
| Standard deviation of domain lengths | 29.32 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 22.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H8M8D8 | 9-234 | SARKAVADVSRGLYREGTDVIDDYARWADTDTEKSTVVELIGYEPYPGAIHGEPVGALQFRATMQPTPNEEPYVACFESQFDFWGVA… |
| A0A5C4J6E7 | 21-243 | SVEDRAADDAREKARRVGNALHGGRVWSAQDMGHRAADLDGIDVMRVGGASTGTPEGVLVVVRTSGSAPEDWPDTGTVTVKRCFELR… |
| A0A7Y9SIR0 | 4-181 | None |
| A0A6N9YTG9 | 50-289 | None |
| A0A3N4ZFV8 | 29-296 | None |
| A0A498B419 | 1-174 | None |
| A0A2X3K903 | 3-182 | None |
| A0A1H5LPG7 | 77-308 | None |
| A0A2P8DEC4 | 55-287 | None |
| A0A7W7CCJ4 | 26-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.