DPCstruct | MC42913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 252 |
|---|---|
| Mean domain length (aa) | 84 ± 18 aa |
| Standard deviation of domain lengths | 18.40 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B1GR91 | 3-75 | VDDYMQRPYTRILESDESGGWSARVLELEGCFSGGDTPDEANRNLSEAMSLWIEFQLEHGYEIPEPIDPATRW |
| A0A3D4EHX0 | 2-78 | KLSYYAVFQYDSDGICISFPDVPPALTCADNEPDGMKYAEEALELALHGMPVDEVPQASSAGQIAVSENQKLFLITA |
| A0A5C6GWP3 | 4-110 | None |
| A0A7W1H118 | 6-103 | None |
| A0A2L2X9J1 | 39-139 | None |
| A0A1H0WLU2 | 1-98 | None |
| A0A1V4X2P5 | 19-83 | None |
| B0JVC6 | 104-178 | None |
| A0A7Y9UQL4 | 100-195 | None |
| A0A0W1AP25 | 5-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.