DPCstruct | MC42912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 103 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03776 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3XCT7 | 91-202 | RSFVEKLGLAFRIFFPKKEVEDARNEAKKRLRMILVADRCSMSPVTLNEMKTTIVGALSNYVVIEDEQGVDLSVSADPKLGTLYSVS… |
| A0A6B1E554 | 16-118 | IIKSLFGRRNRGSGATAKDRLRFVLQHDRIHLPPERMEAMKREILAVIARYLVVDQDRVEIDLEQRDRRQSKLIAEVPFTGQQPANN… |
| A0A136LA38 | 1-110 | None |
| A0A2Z5WX50 | 1-107 | None |
| F7NHP3 | 47-152 | None |
| A0A2W5XN95 | 1-116 | None |
| A0A1H9BHY6 | 1-105 | None |
| Q8RGV0 | 1-99 | None |
| R7M6I3 | 3-120 | None |
| A0A2W4TX34 | 5-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.