DPCstruct | MC4291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 115 ± 14 aa |
| Standard deviation of domain lengths | 14.06 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G8M252 | 6-128 | DDFIREILSISQSVVEKEKVDYNVEKFKESFFRQSSHSPENLESMNYIEYGAVRIKYLGNRRVFGLKVKDKDILLSDIIYFLESDEI… |
| A0A5C4J444 | 5-115 | AKRNFLAAAGAQGDPEALTETFREALQAFGSNTEDNVAAAQRVVFKALQRDGGGTATALALNSTNASLADVLNAAEGTEIPDSVRDA… |
| A0A023BU28 | 1-141 | None |
| A0A4R7HPM3 | 521-639 | None |
| A0A2G9DXB1 | 94-207 | None |
| A0A1W9XAE4 | 5-97 | None |
| A0A496VPE2 | 1-114 | None |
| A0A1W9M441 | 7-101 | None |
| A0A7V9ZQL8 | 6-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.