DPCstruct | MC42909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 185 ± 14 aa |
| Standard deviation of domain lengths | 13.95 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18983 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A396QFL9 | 1-185 | MDQVCKLALLKHYSESGSLTGNQEQQVKRLLSECNGLGLRFEFYSRLPSQLIQAYQIEDKVFIEERFKPDSRVVIHYQLQGEDSGTQ… |
| R7JYY9 | 199-380 | NRPCLLAVLKHLSGRGMLTGGEAVFVDYNLHQLYEKDIVLPYFQAFKDKLSLPDTLLKEQYVDYTADPEHDVKIRYTYIVDDQRQAP… |
| A0A1G4P8W9 | 999-1174 | None |
| A0A417XPG9 | 144-346 | None |
| D3APM6 | 2-160 | None |
| A0A417I3J5 | 838-1040 | None |
| A0A1Y4F6J5 | 456-636 | None |
| D6DDY3 | 92-272 | None |
| A0A7X8QMP2 | 730-899 | None |
| A0A1Y4SB48 | 665-850 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.