DPCstruct | MC42908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 143 ± 29 aa |
| Standard deviation of domain lengths | 28.96 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A396Q724 | 24-185 | IVPITAFAAGVNYIDKISVTYTAPDYKAGDAPQAAASVTEGECSVAYEYWREIEQKTEGSVWTGTGRYWYSDSSKMASLAADKQITQ… |
| A0A1C5VER0 | 142-345 | AVAKEITELPITVTGYALGAKADDIKASTDQMRVTINKVTIKQRNASGGWDNLAPDATIQADIQYGVEILVNAKTGYTYTGLTGDKV… |
| A0A847C5U1 | 22-150 | None |
| A0A7U6KJ31 | 316-421 | None |
| R6H7N7 | 69-210 | None |
| A0A415GN05 | 2-162 | None |
| A0A1I2QAH9 | 30-161 | None |
| D4MQR5 | 7-151 | None |
| A0A096KV21 | 12-188 | None |
| U2UWY2 | 9-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.