DPCstruct | MC42904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 156 ± 20 aa |
| Standard deviation of domain lengths | 20.05 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06333 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9PPV9 | 3-141 | CTQSGGSLGVDSQEEVGTLHQQPLALGYYVSTAPTGRMPRWFWASCPHLENVCPAFLKNSLHLHSPAIQQNSDDLLQQQSTVTVHPL… |
| A0A0R3X9Y6 | 1-130 | LMQQPLALGYYVSTAPVGPLPTWFWAACQQTRRNNPVCLKSSLHLHCTLVGIDDDAAANGGQQCPSSNSATAGGHLLDSSVTCDVLR… |
| A0A2A3EK90 | 39-201 | None |
| A0A814KZI4 | 1-176 | None |
| A0A084WP71 | 320-471 | None |
| A0A819AAM9 | 249-390 | None |
| A0A7J7JGT3 | 671-854 | None |
| A0A183KVQ2 | 391-546 | None |
| A0A814PNU5 | 219-363 | None |
| A0A5E4PVD8 | 601-748 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.