DPCstruct | MC429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 8.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 24.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20390 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5MI19 | 151-240 | SINPSSVEALRERFDILVIDDSAEEQNQFHQAMKAFSATYLWRKLPPPHENSRAIFLPKNETRSRTVAANLKTAGTYDLAALLQAIV… |
| A0A3S0XX17 | 1-95 | MTRHELNTEVAQVILSAFDIFCEPEHHTMNEAFMKRMEAAQIPFAICSAPPPRQDGHHLLLLSCENSKSMGVADIFRAYGWLDVGDL… |
| A0A7X0QH72 | 197-307 | None |
| A0A423Q0Q5 | 7-100 | None |
| W9T9K8 | 187-279 | None |
| A0A261E9F9 | 1-100 | None |
| A0A2V3CQ14 | 210-305 | None |
| W3Y9C4 | 75-185 | None |
| A0A3P8M1R7 | 49-133 | None |
| A0A240UJ64 | 43-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.