DPCstruct | MC42899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 168 ± 11 aa |
| Standard deviation of domain lengths | 10.56 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 67.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 41.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8L6L2 | 1-149 | MCQEDSGLNLSAEEEIAAEESLSVYCKPVELYNILQRRAPLFLQRCLRYKLQAKHKRRIQMTVSVPGIVNEGVPTQTVFPLYILLAR… |
| F6HCX2 | 1-176 | MCHQNSCVHFSAEEAVAAEESLLIYCKPVELYNILQCRALQNPSFLQRCLRYKIQARRKQRLQMTISLSGTIKDGMQAKDLLPVYIL… |
| A0A835R5K0 | 117-283 | None |
| A0A4D6FTI9 | 17-177 | None |
| A0A446KFM2 | 1-173 | None |
| A0A0K9RTZ4 | 30-201 | None |
| A0A445IL98 | 66-235 | None |
| A0A287GV16 | 28-198 | None |
| K7LKC7 | 12-197 | None |
| A0A2U1L2E0 | 16-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.