DPCstruct | MC42896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 210 ± 46 aa |
| Standard deviation of domain lengths | 45.72 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 72.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.09 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF18077- CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9V4P9 | 3-180 | LQSDTRPLSSKEYQGEMVRTIYEFLLEHDGENCLPERVIRSPTKQDFICMFESIYQHLNPDFQLKNVIEEVPAIFRELGYPTAIKPS… |
| I3EES5 | 1-175 | MRRATMAGMPARNSLSSEISRLTLSEDPRRKQRNPREKTHQEENINIIINFLSSTEYDRPFSHALLSNPSSKDFQSIFRHIQSFIDP… |
| A0A177VR15 | 155-334 | None |
| A0A4Y7JCQ0 | 1-290 | None |
| F6H971 | 14-206 | None |
| A0A3N4KM57 | 2-213 | None |
| A0A1A8BI74 | 26-247 | None |
| U6K2B5 | 1-210 | None |
| A0A1R2D338 | 3-186 | None |
| A0A1R3I3H8 | 513-831 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.