DPCstruct | MC42894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 4.68 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 55.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04278 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388K1G0 | 350-428 | MTLDQVCKRLEGVPVYTVTNASNEFVLISGSDENSSKSLGLFCFSQDDAEALLAQVKDREPGLGKGARVVAVSLDKVYQ |
| A0A0E0DYS7 | 88-163 | LAPDEVARALTGTPVFTVCNSSNEFVLVSDPATGLRSLGLLCFRSEDADALLTHVRMRQPVVGRGAKVVPITLDQV |
| A9TPR1 | 168-248 | None |
| A0A1I9LMQ7 | 110-189 | None |
| A0A5N5FCV6 | 83-159 | None |
| A0A7J0F3L0 | 143-220 | None |
| A0A0B2PF70 | 115-187 | None |
| A0A1D6NSC2 | 81-156 | None |
| A0A804HXK8 | 98-175 | None |
| K7MS17 | 21-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.