DPCstruct | MC42892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 55 ± 6 aa |
| Standard deviation of domain lengths | 5.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822HLA6 | 3-52 | IEEVKSTTKTQRISAHSHVKGLGLNDEQRAIRIAGGLVGQEQAREAAGIV |
| A0A7J7LAL8 | 2-56 | QIEEVQSTTKKQRIATHTHIKGLGLQPNGNAVPMAAGFVGQVGGREAAGLVVDMI |
| A0A6V7PPK6 | 3-63 | None |
| A0A453DU39 | 84-133 | None |
| K7H8B2 | 1-59 | None |
| A0A6P5H298 | 57-109 | None |
| A0A7S4NC64 | 3-55 | None |
| A0A842YTD9 | 1-47 | None |
| A0A0N4W949 | 685-746 | None |
| A0A4Z2HFS5 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.