DPCstruct | MC42889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 183 ± 44 aa |
| Standard deviation of domain lengths | 44.26 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 85.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6GYK1 | 11-179 | NDPYIFSTNNFVGRQIWEFDPDYGTPKERAKVEAARENFWKNQFRVKPSSDLLCIRYKASDGHWPAENAGPLFLLPPLVIYLYITRH… |
| A0A6J0VD75 | 51-185 | GLEAHSLGLDTSKFFPTLPDASTAEEAAINGMKFYSGLQAEDGHWAGDYGGPLFLLPGLLIACHVAKIPLPEESKKEMVRYLRSIQL… |
| A0A2G5D0F0 | 1-244 | None |
| A0A7V8VDQ5 | 4-162 | None |
| A0A067JM13 | 1-249 | None |
| A0A0V0QK42 | 351-674 | None |
| A0A5A7QXW6 | 279-517 | None |
| A0A803KQK9 | 5-159 | None |
| Q1PVG6 | 41-190 | None |
| A0A067KXK6 | 1-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.