DPCstruct | MC42885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 105 ± 8 aa |
| Standard deviation of domain lengths | 8.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11843 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0ZB26 | 215-321 | TRNRDGRIFYRRNLLATLREREVARAGAEMAEGKALPFRAAKDGESVSGKFTGTVHLSSGKFAVVEESHEFTLVPWRPIIDRQLGRE… |
| A0A1G3JIX5 | 62-170 | SQQDGQVLLPSNLLDRLHRHEFEKVQESISKTTGKPMLPNQFGESVEGIYRGQFRLSAGRFALIDNGFALQLVPWQRELERHLGDTV… |
| A0A2K9NLI2 | 302-410 | None |
| A0A8B3IUF9 | 175-273 | None |
| A0A2E4R082 | 253-341 | None |
| A0A2A4FN03 | 1-91 | None |
| A0A0L1KDX6 | 392-500 | None |
| A0A3G9G326 | 391-498 | None |
| A0A094ZRF9 | 102-211 | None |
| A0A401WYY5 | 95-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.