DPCstruct | MC42884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 63 ± 6 aa |
| Standard deviation of domain lengths | 5.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 63.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A828U076 | 9-70 | TAQLRLGPADILESDENGIIPEQARVITQVVILDADKKQIQCVVRPLQILRADGTWENIGGM |
| A0A828AP14 | 4-70 | ETQIRFRLGPMSIIETNSYGWFPDTDGALITGLTFLDPKDATQVQGMFQHLQVRFGDGPWQDVKGLD |
| A0A7U8ZMB8 | 1-65 | None |
| A0A735V831 | 134-197 | None |
| A0A3I8FTC9 | 17-79 | None |
| A0A5N2JVP1 | 1-55 | None |
| G8GJF6 | 60-129 | None |
| A0A6C7CSQ7 | 8-62 | None |
| W0AVK8 | 20-89 | None |
| A0A3W1EDC6 | 18-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.