DPCstruct | MC42870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 8.53 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G7GGW8 | 7-95 | HRKAELSEEEIFNQTLNIAHDEDVSVWVRAIAAYLQQNNDNAVTLAQLQQALNIPLVNVWLGLLLSEKQYKWQRGESFYQDAREVWL… |
| K9UC79 | 40-124 | ESEEIDPEVAYQQAMALAHDENVSEWGAAISVGLDEWDNESVPLLELQRSIEMPLVQVWLGLLLNGFKIEQRGEFYETEQVWVLR |
| A0A367RJE6 | 1-81 | None |
| U9VZA1 | 59-134 | None |
| A0A2T1CEV7 | 92-195 | None |
| A0A7Y5I9X9 | 71-149 | None |
| A0A2W7A819 | 377-460 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.