DPCstruct | MC42869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 141 ± 33 aa |
| Standard deviation of domain lengths | 33.41 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02690 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G7GFB4 | 2-143 | PIIALGVVVAMTSLPYFLGANIGTSITALIAAMSLASDGSAEGVASLTVAWVHMVFDLYAIALLYPTKYTRKLPVWLAEKSANFVTA… |
| A0A160P6W9 | 23-131 | PFAGTGILTPAQVYPVVVGSNLGTTFTVVFAAFAGVGPDAEIGLQAAFVHLIHNLFAIVAIYVTPLLRPVPLLCAENLARVAAEHRW… |
| A0A6A4V5G3 | 236-443 | None |
| A0A820GQ75 | 136-240 | None |
| A0A6G0X361 | 3-132 | None |
| A0A812P2Y4 | 236-361 | None |
| A0A7E4W6R3 | 189-325 | None |
| A0A7S2VPL1 | 184-313 | None |
| A0A2C9K937 | 2-132 | None |
| A0A6P8UHF2 | 51-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.